Quiet essentials · Free shipping over $75 · Shop the edit

CORO2B Polyclonal Antibody - E-AB-91609 Size:60μL Lane 1: Mouse testis tissue

SKU: 10850508398

4.1
USD140.00 USD168.00

Pay in 4 interest-free payments of $35.00 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Description

Lane 1: Mouse testis tissue

AA Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

breast and colon cancers

Phospho-LRP5 (Tyr1473) Antibody

inhibiting axonal extension

CORO2B Polyclonal Antibody - E-AB-91609 Size:60μL Lane 1: Mouse testis tissueCORO2B Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 91609 60, E AB 91609 120, E AB 91609 200 Citations, Manuals and MSDS Available upon request. Abbreviation: CORO2B Target Synonym: CORO2B; CLIPINC Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human, Mouse, Rat Application: WB Isotype: IgG Clonality: Polyclonal UNIProt ID: Q9UQ03 Background: This protein may play a role in the reorganization of neuronal actin

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products